Lineage for d1hnwc2 (1hnw C:107-207)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32222Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
  4. 32223Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 32224Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 32225Protein Ribosomal protein S3 C-terminal domain [54823] (1 species)
  7. 32226Species Thermus thermophilus [TaxId:274] [54824] (6 PDB entries)
  8. 32231Domain d1hnwc2: 1hnw C:107-207 [38842]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwc2

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d1hnwc2:

Click to download the PDB-style file with coordinates for d1hnwc2.
(The format of our PDB-style files is described here.)

Timeline for d1hnwc2: