Lineage for d1hnwi_ (1hnw I:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) 
Family d.14.1.1: Translational machinery components [54212] (3 proteins) 
Protein Ribosomal protein S9 [54218] (1 species) Species Thermus thermophilus [TaxId:274] [54219] (6 PDB entries) 
Domain d1hnwi_: 1hnw I: [37562]
Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_
Details for d1hnwi_
PDB Entry: 1hnw (more details), 3.4 Å
PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
SCOP Domain Sequences for d1hnwi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnwi_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr
SCOP Domain Coordinates for d1hnwi_:
Click to download the PDB-style file with coordinates for d1hnwi_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hnwi_:
- d1hnwi_ appears in SCOP 1.57
- d1hnwi_ appears in the current release, SCOPe 2.08
View in 3D
