Lineage for d1hnwo_ (1hnw O:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2004Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
  4. 2005Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 2012Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
  6. 2013Protein Ribosomal protein S15 [47065] (2 species)
  7. 2016Species Thermus thermophilus [TaxId:274] [47067] (10 PDB entries)
  8. 2025Domain d1hnwo_: 1hnw O: [16391]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwo_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwo_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1hnwo_:

Click to download the PDB-style file with coordinates for d1hnwo_.
(The format of our PDB-style files is described here.)

Timeline for d1hnwo_: