Lineage for d1hnwf_ (1hnw F:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) 
Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) Protein Ribosomal protein S6 [54997] (1 species) Species Thermus thermophilus [TaxId:274] [54998] (12 PDB entries) 
Domain d1hnwf_: 1hnw F: [39319]
Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_
Details for d1hnwf_
PDB Entry: 1hnw (more details), 3.4 Å
PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
SCOP Domain Sequences for d1hnwf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnwf_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
SCOP Domain Coordinates for d1hnwf_:
Click to download the PDB-style file with coordinates for d1hnwf_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hnwf_:
- d1hnwf_ appears in SCOP 1.57
- d1hnwf_ appears in the current release, SCOPe 2.08
View in 3D
