SCOP 1.75: Domain d2zjrn1: 2zjr N:2-118

Lineage for d2zjrn1 (2zjr N:2-118)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.144: PABP domain-like [63569] (2 superfamilies)
   4 helices; an orthogonal array

4. Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family)

5. Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)

6. Protein Ribosomal protein L20 [74733] (4 species)

7. Species Deinococcus radiodurans [TaxId:1299] [158512] (10 PDB entries)
   Uniprot Q9RSW7 2-118

8. Domain d2zjrn1: 2zjr N:2-118 [154567]
   Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
   Representative structure
   complexed with mg

Details for d2zjrn1

PDB Entry: 2zjr, 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans

PDB Compounds: (N:) 50S ribosomal protein L20

SCOP Domain Sequences for d2zjrn1:

Sequence; same for both SEQRES and ATOM records:

>d2zjrn1 a.144.2.1 (N:2-118) Ribosomal protein L20 {Deinococcus radiodurans [TaxId: 1299]}
praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq

Timeline for d2zjrn1:

• d2zjrn1 is new in SCOP 1.75
  
• d2zjrn1 appears in SCOPe 2.01
  
• d2zjrn1 appears in the current release, SCOPe 2.08