Lineage for d2zjr31 (2zjr 3:2-64)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882221Fold d.301: L35p-like [143033] (1 superfamily)
    core: alpha-beta(3)-alpha; 2layers a/b
  4. 882222Superfamily d.301.1: L35p-like [143034] (1 family) (S)
  5. 882223Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein)
    Pfam PF01632
  6. 882224Protein Ribosomal protein L35p [143036] (3 species)
  7. 882225Species Deinococcus radiodurans [TaxId:1299] [160056] (10 PDB entries)
    Uniprot Q9RSW6 2-64
  8. 882226Domain d2zjr31: 2zjr 3:2-64 [154551]
    Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
    Representative structure
    complexed with mg

Details for d2zjr31

PDB Entry: 2zjr (more details), 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans
PDB Compounds: (3:) 50S ribosomal protein L35

SCOP Domain Sequences for d2zjr31:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjr31 d.301.1.1 (3:2-64) Ribosomal protein L35p {Deinococcus radiodurans [TaxId: 1299]}
pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
lpr

SCOP Domain Coordinates for d2zjr31:

Click to download the PDB-style file with coordinates for d2zjr31.
(The format of our PDB-style files is described here.)

Timeline for d2zjr31: