Lineage for d2zjrt1 (2zjr T:2-85)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 810794Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 810963Superfamily b.84.4: Ribosomal L27 protein-like [110324] (2 families) (S)
    rudiment single hybrid fold with a permuted topology
  5. 810964Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein)
    Pfam PF01016
  6. 810965Protein Ribosomal protein L27 [110326] (3 species)
  7. 810966Species Deinococcus radiodurans [TaxId:1299] [159323] (11 PDB entries)
    Uniprot Q9RY65 2-85
  8. 810967Domain d2zjrt1: 2zjr T:2-85 [154573]
    Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
    Representative structure
    complexed with mg

Details for d2zjrt1

PDB Entry: 2zjr (more details), 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans
PDB Compounds: (T:) 50S ribosomal protein L27

SCOP Domain Sequences for d2zjrt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjrt1 b.84.4.1 (T:2-85) Ribosomal protein L27 {Deinococcus radiodurans [TaxId: 1299]}
ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
lsdgkvvfinkgkgarfisieaaq

SCOP Domain Coordinates for d2zjrt1:

Click to download the PDB-style file with coordinates for d2zjrt1.
(The format of our PDB-style files is described here.)

Timeline for d2zjrt1: