SCOP 1.75: Domain d2zjra2: 2zjr A:33-127

Lineage for d2zjra2 (2zjr A:33-127)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Deinococcus radiodurans [TaxId:1299] [159085] (5 PDB entries)
   Uniprot Q9RXJ9 33-127

8. Domain d2zjra2: 2zjr A:33-127 [154554]
   Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
   Representative structure
   complexed with mg

Details for d2zjra2

PDB Entry: 2zjr, 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans

PDB Compounds: (A:) 50S ribosomal protein L2

SCOP Domain Sequences for d2zjra2:

Sequence; same for both SEQRES and ATOM records:

>d2zjra2 b.40.4.5 (A:33-127) N-terminal domain of ribosomal protein L2 {Deinococcus radiodurans [TaxId: 1299]}
ltealpktggrnnrgritsrfiggghkrlyriidfkrrdksgvnakvaaieydpnrsari
allhyadgekryilapegltvgatvnagpeaepkl

Timeline for d2zjra2:

• d2zjra2 is new in SCOP 1.75
  
• d2zjra2 appears in SCOPe 2.01
  
• d2zjra2 appears in the current release, SCOPe 2.08