SCOP 1.75: Domain d2zjrh1: 2zjr H:1-134

Lineage for d2zjrh1 (2zjr H:1-134)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
   barrel, closed; n=5, S=8, meander

4. Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family)

5. Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)

6. Protein Ribosomal protein L14 [50195] (5 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159079] (6 PDB entries)
   Uniprot Q9RXJ2 1-134

8. Domain d2zjrh1: 2zjr H:1-134 [154561]
   Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
   Representative structure
   complexed with mg

Details for d2zjrh1

PDB Entry: 2zjr, 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans

PDB Compounds: (H:) 50S ribosomal protein L14

SCOP Domain Sequences for d2zjrh1:

Sequence; same for both SEQRES and ATOM records:

>d2zjrh1 b.39.1.1 (H:1-134) Ribosomal protein L14 {Deinococcus radiodurans [TaxId: 1299]}
mimpqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaap
rgavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrd
rrfmkivslapevl

Timeline for d2zjrh1:

• d2zjrh1 is new in SCOP 1.75
  
• d2zjrh1 appears in SCOPe 2.01
  
• d2zjrh1 appears in the current release, SCOPe 2.08