Lineage for d2zjrd1 (2zjr D:3-179)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865505Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 865506Superfamily d.77.1: RL5-like [55282] (2 families) (S)
  5. 865507Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 865508Protein Ribosomal protein L5 [55284] (5 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 865553Species Deinococcus radiodurans [TaxId:1299] [160487] (6 PDB entries)
    Uniprot Q9RXJ0 3-179
  8. 865554Domain d2zjrd1: 2zjr D:3-179 [154557]
    Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
    Representative structure
    complexed with mg

Details for d2zjrd1

PDB Entry: 2zjr (more details), 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans
PDB Compounds: (D:) 50S ribosomal protein L5

SCOP Domain Sequences for d2zjrd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjrd1 d.77.1.1 (D:3-179) Ribosomal protein L5 {Deinococcus radiodurans [TaxId: 1299]}
qlktkyndqvrpalmqqfgyssvmavpriekivvneglgsskedskaidkaakelalitl
qkpiitkakksisnfklrqgmpvgikvtlrgermyvflekliniglprirdfrginpnaf
dgrgnynlgikeqlifpeitydmvdktrgmditivttaktdeearallqsmglpfrk

SCOP Domain Coordinates for d2zjrd1:

Click to download the PDB-style file with coordinates for d2zjrd1.
(The format of our PDB-style files is described here.)

Timeline for d2zjrd1: