Lineage for d2zjro1 (2zjr O:5-98)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813866Fold b.155: L21p-like [141090] (1 superfamily)
    core: sandwich, 6 strands in 2 sheets
  4. 813867Superfamily b.155.1: L21p-like [141091] (1 family) (S)
  5. 813868Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
    Pfam PF00829
  6. 813869Protein Ribosomal protein L21p [141093] (3 species)
  7. 813870Species Deinococcus radiodurans [TaxId:1299] [158938] (10 PDB entries)
    Uniprot Q9RY64 5-98
  8. 813871Domain d2zjro1: 2zjr O:5-98 [154568]
    Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
    Representative structure
    complexed with mg

Details for d2zjro1

PDB Entry: 2zjr (more details), 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans
PDB Compounds: (O:) 50S ribosomal protein L21

SCOP Domain Sequences for d2zjro1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjro1 b.155.1.1 (O:5-98) Ribosomal protein L21p {Deinococcus radiodurans [TaxId: 1299]}
iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg
rgkkiyirkyksgvqyrrrtghrqnftaikilgi

SCOP Domain Coordinates for d2zjro1:

Click to download the PDB-style file with coordinates for d2zjro1.
(The format of our PDB-style files is described here.)

Timeline for d2zjro1: