SCOP 1.75: Domain d2zjrw1: 2zjr W:1-55

Lineage for d2zjrw1 (2zjr W:1-55)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
   core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold

4. Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family)

5. Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)

6. Protein Prokaryotic ribosomal protein L30 [55131] (3 species)
   short-chain member of the family

7. Species Deinococcus radiodurans [TaxId:1299] [160396] (6 PDB entries)
   Uniprot Q9RSL0 1-55

8. Domain d2zjrw1: 2zjr W:1-55 [154576]
   Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrz1
   Representative structure
   complexed with mg

Details for d2zjrw1

PDB Entry: 2zjr, 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans

PDB Compounds: (W:) 50S ribosomal protein L30

SCOP Domain Sequences for d2zjrw1:

Sequence; same for both SEQRES and ATOM records:

>d2zjrw1 d.59.1.1 (W:1-55) Prokaryotic ribosomal protein L30 {Deinococcus radiodurans [TaxId: 1299]}
mkiklvrsvigrpgnqvktvqalglrkigdsrevsdtpavrgmvktvkhllevqe

Timeline for d2zjrw1:

• d2zjrw1 is new in SCOP 1.75
  
• d2zjrw1 appears in SCOPe 2.01
  
• d2zjrw1 appears in the current release, SCOPe 2.08