SCOP 1.75: Domain d2zjre2: 2zjr E:5-82

Lineage for d2zjre2 (2zjr E:5-82)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Deinococcus radiodurans [TaxId:1299] [160798] (6 PDB entries)
   Uniprot Q9RSL3 8-82! Uniprot Q9RSL3 83-172

8. Domain d2zjre2: 2zjr E:5-82 [154559]
   Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
   Representative structure
   complexed with mg

Details for d2zjre2

PDB Entry: 2zjr, 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans

PDB Compounds: (E:) 50S ribosomal protein L6

SCOP Domain Sequences for d2zjre2:

Sequence; same for both SEQRES and ATOM records:

>d2zjre2 d.141.1.1 (E:5-82) Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1299]}
gkqpiavpsgvtvnaqdgvfkvkgpkgeltvpynteltvrqdgdqllverpsdaqkhral
hgltrtlvanavkgvsdg

Timeline for d2zjre2:

• d2zjre2 is new in SCOP 1.75
  
• d2zjre2 appears in SCOPe 2.01
  
• d2zjre2 appears in the current release, SCOPe 2.08