Lineage for d2zjrl1 (2zjr L:8-111)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 837367Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 837368Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 837369Protein Ribosomal protein L18 (L18p) [53139] (5 species)
  7. 837413Species Deinococcus radiodurans [TaxId:1299] [159643] (6 PDB entries)
    Uniprot Q9RSL2 8-111
  8. 837414Domain d2zjrl1: 2zjr L:8-111 [154565]
    Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
    Representative structure
    complexed with mg

Details for d2zjrl1

PDB Entry: 2zjr (more details), 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans
PDB Compounds: (L:) 50S ribosomal protein L18

SCOP Domain Sequences for d2zjrl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjrl1 c.55.4.1 (L:8-111) Ribosomal protein L18 (L18p) {Deinococcus radiodurans [TaxId: 1299]}
rrklrtrrkvrtttaasgrlrlsvyrsskhiyaqiiddsrgqtlaaassaalksgnktdt
aaavgkalaaaaaekgikqvvfdrgsykyhgrvkaladaaregg

SCOP Domain Coordinates for d2zjrl1:

Click to download the PDB-style file with coordinates for d2zjrl1.
(The format of our PDB-style files is described here.)

Timeline for d2zjrl1: