Lineage for d2zjrn1 (2zjr N:2-118)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734855Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2734896Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) (S)
    automatically mapped to Pfam PF00453
  5. 2734897Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)
  6. 2734898Protein Ribosomal protein L20 [74733] (4 species)
  7. 2734901Species Deinococcus radiodurans [TaxId:1299] [158512] (6 PDB entries)
    Uniprot Q9RSW7 2-118
  8. 2734902Domain d2zjrn1: 2zjr N:2-118 [154567]
    Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
    Representative structure
    complexed with mg

Details for d2zjrn1

PDB Entry: 2zjr (more details), 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans
PDB Compounds: (N:) 50S ribosomal protein L20

SCOPe Domain Sequences for d2zjrn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjrn1 a.144.2.1 (N:2-118) Ribosomal protein L20 {Deinococcus radiodurans [TaxId: 1299]}
praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq

SCOPe Domain Coordinates for d2zjrn1:

Click to download the PDB-style file with coordinates for d2zjrn1.
(The format of our PDB-style files is described here.)

Timeline for d2zjrn1: