Lineage for d2zjrw1 (2zjr W:1-55)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956419Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 2956420Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 2956421Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 2956464Protein Prokaryotic ribosomal protein L30 [55131] (3 species)
    short-chain member of the family
  7. 2956465Species Deinococcus radiodurans [TaxId:1299] [160396] (6 PDB entries)
    Uniprot Q9RSL0 1-55
  8. 2956466Domain d2zjrw1: 2zjr W:1-55 [154576]
    Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrz1
    Representative structure
    complexed with mg

Details for d2zjrw1

PDB Entry: 2zjr (more details), 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans
PDB Compounds: (W:) 50S ribosomal protein L30

SCOPe Domain Sequences for d2zjrw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjrw1 d.59.1.1 (W:1-55) Prokaryotic ribosomal protein L30 {Deinococcus radiodurans [TaxId: 1299]}
mkiklvrsvigrpgnqvktvqalglrkigdsrevsdtpavrgmvktvkhllevqe

SCOPe Domain Coordinates for d2zjrw1:

Click to download the PDB-style file with coordinates for d2zjrw1.
(The format of our PDB-style files is described here.)

Timeline for d2zjrw1: