![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.144: PABP domain-like [63569] (2 superfamilies) 4 helices; an orthogonal array |
![]() | Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) ![]() automatically mapped to Pfam PF00453 |
![]() | Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein) |
![]() | Protein Ribosomal protein L20 [74733] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [158510] (15 PDB entries) Uniprot P60491 1-117 |
![]() | Domain d2v49u1: 2v49 U:2-118 [152552] Other proteins in same PDB: d2v4941, d2v4951, d2v4961, d2v4971, d2v49e1, d2v49f1, d2v49h1, d2v49h2, d2v49n1, d2v49p1, d2v49t1, d2v49v1, d2v49y1, d2v49z1 |
PDB Entry: 2v49 (more details), 3.8 Å
SCOPe Domain Sequences for d2v49u1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v49u1 a.144.2.1 (U:2-118) Ribosomal protein L20 {Thermus thermophilus [TaxId: 274]} praktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrlw ivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg
Timeline for d2v49u1: