![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.21: Ribosomal protein L13 [52160] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) ![]() |
![]() | Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein) |
![]() | Protein Ribosomal protein L13 [52163] (5 species) synonym: 50S ribosomal protein L13p, HMAL13 |
![]() | Species Thermus thermophilus [TaxId:274] [159473] (14 PDB entries) Uniprot P60488 1-139 |
![]() | Domain d2v49n1: 2v49 N:1-139 [152549] Other proteins in same PDB: d2v4941, d2v4951, d2v4961, d2v4971, d2v49e1, d2v49f1, d2v49h1, d2v49h2, d2v49p1, d2v49t1, d2v49u1, d2v49v1, d2v49y1, d2v49z1 |
PDB Entry: 2v49 (more details), 3.8 Å
SCOPe Domain Sequences for d2v49n1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v49n1 c.21.1.1 (N:1-139) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]} mktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadki rvtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrl kvyagpdhphqaqrpekle
Timeline for d2v49n1: