SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2v49t1 (2v49 T:1-138)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2046659Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2046932Family b.34.5.6: Ribosomal protein L19 [141245] (1 protein)
    Pfam PF01245
  6. 2046933Protein Ribosomal protein L19 [141246] (3 species)
  7. 2046951Species Thermus thermophilus [TaxId:274] [159030] (4 PDB entries)
    Uniprot P60490 1-138
  8. 2046955Domain d2v49t1: 2v49 T:1-138 [152551]
    Other proteins in same PDB: d2v4941, d2v4951, d2v4961, d2v4971, d2v49e1, d2v49f1, d2v49h1, d2v49h2, d2v49n1, d2v49p1, d2v49u1, d2v49v1, d2v49y1, d2v49z1

Details for d2v49t1

PDB Entry: 2v49 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 4 of 4). This file contains the 50S subunit of Molecule 2.
PDB Compounds: (T:) 50S ribosomal protein L19

SCOPe Domain Sequences for d2v49t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v49t1 b.34.5.6 (T:1-138) Ribosomal protein L19 {Thermus thermophilus [TaxId: 274]}
mnrgaliklvesryvrtdlpefrpgdtvrvsykvkegnrtriqdfegivirirrngfntt
ftvrkvsygvgverifplhspliqkidivqrgrarraklyfirnlsdreirrklradrkr
idqdraaeraakeeaqka

SCOPe Domain Coordinates for d2v49t1:

Click to download the PDB-style file with coordinates for d2v49t1.
(The format of our PDB-style files is described here.)

Timeline for d2v49t1: