Class g: Small proteins [56992] (100 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) |
Family g.41.8.6: Ribosomal protein L33p [144203] (1 protein) Pfam PF00471; corresponds structurally and functionally to the ribosomal L44e from eukaryota and archaea; metal ion-binding site is lost in most members |
Protein Ribosomal protein L33p [144204] (3 species) |
Species Thermus thermophilus [TaxId:274] [161180] (9 PDB entries) Uniprot P35871 8-52 |
Domain d2v4961: 2v49 6:9-53 [152543] Other proteins in same PDB: d2v4941, d2v4951, d2v4971, d2v49e1, d2v49f1, d2v49h1, d2v49h2, d2v49n1, d2v49p1, d2v49t1, d2v49u1, d2v49v1, d2v49y1, d2v49z1 |
PDB Entry: 2v49 (more details), 3.8 Å
SCOPe Domain Sequences for d2v4961:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v4961 g.41.8.6 (6:9-53) Ribosomal protein L33p {Thermus thermophilus [TaxId: 274]} lllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrevk
Timeline for d2v4961: