Lineage for d2v4941 (2v49 4:1-50)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010997Fold d.325: L28p-like [143799] (1 superfamily)
    unusual fold consisting of three beta-hairpins, that form a paper clip-like structure, and two helices; could have evolved from a glucocorticoid receptor-like zinc finger domain (57715)
  4. 3010998Superfamily d.325.1: L28p-like [143800] (2 families) (S)
    In early ribosomal structures, L28p has been misinterpreted as L31p. in the Ribosomal protein L28p family, there are sequences containing two CxxC pairs. Threading these sequences into this fold brings the four cysteines in a similar site to the zinc-binding site of glucocorticoid receptor-like zinc fingers. In the Ribosomal protein L31p, there are also members with two CxxC pairs. However, these won't form a putative zinc-binding site in this fold. The L31p family are classified here temporarily, until its true fold is known
  5. 3011031Family d.325.1.2: Ribosomal protein L31p [143804] (1 protein)
    Pfam PF01197
  6. 3011032Protein Ribosomal protein L31p [143805] (2 species)
  7. 3011043Species Thermus thermophilus [TaxId:274] [160711] (7 PDB entries)
    Uniprot Q5SJE1 1-50
  8. 3011047Domain d2v4941: 2v49 4:1-50 [152541]
    Other proteins in same PDB: d2v4951, d2v4961, d2v4971, d2v49e1, d2v49f1, d2v49h1, d2v49h2, d2v49n1, d2v49p1, d2v49t1, d2v49u1, d2v49v1, d2v49y1, d2v49z1

Details for d2v4941

PDB Entry: 2v49 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 4 of 4). This file contains the 50S subunit of Molecule 2.
PDB Compounds: (4:) 50S ribosomal protein L31

SCOPe Domain Sequences for d2v4941:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v4941 d.325.1.2 (4:1-50) Ribosomal protein L31p {Thermus thermophilus [TaxId: 274]}
mkegihpklvpariicgcgnvietystkpeiyvevcskchpfytgqqrfv

SCOPe Domain Coordinates for d2v4941:

Click to download the PDB-style file with coordinates for d2v4941.
(The format of our PDB-style files is described here.)

Timeline for d2v4941: