Lineage for d2v49t1 (2v49 T:1-138)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796588Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 796856Family b.34.5.6: Ribosomal protein L19 [141245] (1 protein)
    Pfam PF01245
  6. 796857Protein Ribosomal protein L19 [141246] (3 species)
  7. 796875Species Thermus thermophilus [TaxId:274] [159030] (4 PDB entries)
    Uniprot P60490 1-138
  8. 796879Domain d2v49t1: 2v49 T:1-138 [152551]
    Other proteins in same PDB: d2v4941, d2v4951, d2v4961, d2v4971, d2v49e1, d2v49f1, d2v49h1, d2v49h2, d2v49n1, d2v49p1, d2v49u1, d2v49v1, d2v49y1, d2v49z1
    automatically matched to 2J01 T:1-138

Details for d2v49t1

PDB Entry: 2v49 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 4 of 4). This file contains the 50S subunit of Molecule 2.
PDB Compounds: (T:) 50S ribosomal protein L19

SCOP Domain Sequences for d2v49t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v49t1 b.34.5.6 (T:1-138) Ribosomal protein L19 {Thermus thermophilus [TaxId: 274]}
mnrgaliklvesryvrtdlpefrpgdtvrvsykvkegnrtriqdfegivirirrngfntt
ftvrkvsygvgverifplhspliqkidivqrgrarraklyfirnlsdreirrklradrkr
idqdraaeraakeeaqka

SCOP Domain Coordinates for d2v49t1:

Click to download the PDB-style file with coordinates for d2v49t1.
(The format of our PDB-style files is described here.)

Timeline for d2v49t1: