Class g: Small proteins [56992] (90 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) |
Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein) Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail |
Protein Ribosomal protein L32p [144201] (3 species) |
Species Thermus thermophilus [TaxId:274] [161177] (7 PDB entries) Uniprot P80339 1-59 |
Domain d2v4951: 2v49 5:2-60 [152542] Other proteins in same PDB: d2v4941, d2v4961, d2v4971, d2v49e1, d2v49f1, d2v49h1, d2v49h2, d2v49n1, d2v49p1, d2v49t1, d2v49u1, d2v49v1, d2v49y1, d2v49z1 automatically matched to 2J01 5:2-60 |
PDB Entry: 2v49 (more details), 3.8 Å
SCOP Domain Sequences for d2v4951:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v4951 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} akhpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvlev
Timeline for d2v4951: