Class b: All beta proteins [48724] (174 folds) |
Fold b.155: L21p-like [141090] (1 superfamily) core: sandwich, 6 strands in 2 sheets |
Superfamily b.155.1: L21p-like [141091] (1 family) |
Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein) Pfam PF00829 |
Protein Ribosomal protein L21p [141093] (3 species) |
Species Thermus thermophilus [TaxId:274] [158939] (11 PDB entries) Uniprot P60492 1-101 |
Domain d2v49v1: 2v49 V:1-101 [152553] Other proteins in same PDB: d2v4941, d2v4951, d2v4961, d2v4971, d2v49e1, d2v49f1, d2v49h1, d2v49h2, d2v49n1, d2v49p1, d2v49t1, d2v49u1, d2v49y1, d2v49z1 automatically matched to 2HGJ U:1-101 |
PDB Entry: 2v49 (more details), 3.8 Å
SCOP Domain Sequences for d2v49v1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v49v1 b.155.1.1 (V:1-101) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]} mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg
Timeline for d2v49v1: