Lineage for d2v49v1 (2v49 V:1-101)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 967763Fold b.155: L21p-like [141090] (1 superfamily)
    core: sandwich, 6 strands in 2 sheets
  4. 967764Superfamily b.155.1: L21p-like [141091] (1 family) (S)
  5. 967765Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
    Pfam PF00829
  6. 967766Protein Ribosomal protein L21p [141093] (3 species)
  7. 967806Species Thermus thermophilus [TaxId:274] [158939] (11 PDB entries)
    Uniprot P60492 1-101
  8. 967812Domain d2v49v1: 2v49 V:1-101 [152553]
    Other proteins in same PDB: d2v4941, d2v4951, d2v4961, d2v4971, d2v49e1, d2v49f1, d2v49h1, d2v49h2, d2v49n1, d2v49p1, d2v49t1, d2v49u1, d2v49y1, d2v49z1
    automatically matched to 2HGJ U:1-101

Details for d2v49v1

PDB Entry: 2v49 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 4 of 4). This file contains the 50S subunit of Molecule 2.
PDB Compounds: (V:) 50S ribosomal protein L21

SCOPe Domain Sequences for d2v49v1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v49v1 b.155.1.1 (V:1-101) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]}
mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg

SCOPe Domain Coordinates for d2v49v1:

Click to download the PDB-style file with coordinates for d2v49v1.
(The format of our PDB-style files is described here.)

Timeline for d2v49v1: