![]() | Class j: Peptides [58231] (120 folds) |
![]() | Fold j.118: Ribosomal protein L34p [144320] (1 superfamily) non-globular, mainly alpha-helical |
![]() | Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) ![]() |
![]() | Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein) Pfam PF00468 |
![]() | Protein Ribosomal protein L34p [144323] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [161306] (11 PDB entries) Uniprot P80340 1-49 |
![]() | Domain d2v4971: 2v49 7:1-49 [152544] Other proteins in same PDB: d2v4941, d2v4951, d2v4961, d2v49e1, d2v49f1, d2v49h1, d2v49h2, d2v49n1, d2v49p1, d2v49t1, d2v49u1, d2v49v1, d2v49y1, d2v49z1 automatically matched to 2J01 7:1-49 |
PDB Entry: 2v49 (more details), 3.8 Å
SCOPe Domain Sequences for d2v4971:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v4971 j.118.1.1 (7:1-49) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]} mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrkr
Timeline for d2v4971: