Lineage for d2v49y1 (2v49 Y:2-102)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783937Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2783938Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 2783981Protein Ribosomal proteins L24 (L24p) [50106] (4 species)
  7. 2784062Species Thermus thermophilus [TaxId:274] [159025] (15 PDB entries)
    Uniprot Q72I15 2-102
  8. 2784068Domain d2v49y1: 2v49 Y:2-102 [152554]
    Other proteins in same PDB: d2v4941, d2v4951, d2v4961, d2v4971, d2v49e1, d2v49f1, d2v49h1, d2v49h2, d2v49n1, d2v49p1, d2v49t1, d2v49u1, d2v49v1, d2v49z1

Details for d2v49y1

PDB Entry: 2v49 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 4 of 4). This file contains the 50S subunit of Molecule 2.
PDB Compounds: (Y:) 50S ribosomal protein L24

SCOPe Domain Sequences for d2v49y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v49y1 b.34.5.1 (Y:2-102) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]}
rvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggfi
ekeaplhaskvrpicpacgkptrvrkkflengkkirvcakc

SCOPe Domain Coordinates for d2v49y1:

Click to download the PDB-style file with coordinates for d2v49y1.
(The format of our PDB-style files is described here.)

Timeline for d2v49y1: