Lineage for d2v4951 (2v49 5:2-60)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2588084Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 2588236Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
    Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail
  6. 2588237Protein Ribosomal protein L32p [144201] (3 species)
  7. 2588273Species Thermus thermophilus [TaxId:274] [161177] (11 PDB entries)
    Uniprot P80339 1-59
  8. 2588277Domain d2v4951: 2v49 5:2-60 [152542]
    Other proteins in same PDB: d2v4941, d2v4961, d2v4971, d2v49e1, d2v49f1, d2v49h1, d2v49h2, d2v49n1, d2v49p1, d2v49t1, d2v49u1, d2v49v1, d2v49y1, d2v49z1

Details for d2v4951

PDB Entry: 2v49 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 4 of 4). This file contains the 50S subunit of Molecule 2.
PDB Compounds: (5:) 50S ribosomal protein L32

SCOPe Domain Sequences for d2v4951:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v4951 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]}
akhpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvlev

SCOPe Domain Coordinates for d2v4951:

Click to download the PDB-style file with coordinates for d2v4951.
(The format of our PDB-style files is described here.)

Timeline for d2v4951: