Lineage for d2v4971 (2v49 7:1-49)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3047480Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 3047481Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) (S)
  5. 3047482Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
    Pfam PF00468
  6. 3047483Protein Ribosomal protein L34p [144323] (3 species)
  7. 3047500Species Thermus thermophilus [TaxId:274] [161306] (15 PDB entries)
    Uniprot P80340 1-49
  8. 3047506Domain d2v4971: 2v49 7:1-49 [152544]
    Other proteins in same PDB: d2v4941, d2v4951, d2v4961, d2v49e1, d2v49f1, d2v49h1, d2v49h2, d2v49n1, d2v49p1, d2v49t1, d2v49u1, d2v49v1, d2v49y1, d2v49z1

Details for d2v4971

PDB Entry: 2v49 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 4 of 4). This file contains the 50S subunit of Molecule 2.
PDB Compounds: (7:) 50S ribosomal protein L34

SCOPe Domain Sequences for d2v4971:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v4971 j.118.1.1 (7:1-49) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]}
mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrkr

SCOPe Domain Coordinates for d2v4971:

Click to download the PDB-style file with coordinates for d2v4971.
(The format of our PDB-style files is described here.)

Timeline for d2v4971: