Lineage for d2v49z1 (2v49 Z:3-179)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802937Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 2802938Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) (S)
  5. 2802939Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins)
  6. 2802974Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species)
    contains additional all-beta (sub)domain in the C-terminal extension
  7. 2802982Species Thermus thermophilus [TaxId:274] [63799] (16 PDB entries)
  8. 2802990Domain d2v49z1: 2v49 Z:3-179 [152555]
    Other proteins in same PDB: d2v4941, d2v4951, d2v4961, d2v4971, d2v49e1, d2v49f1, d2v49h1, d2v49h2, d2v49n1, d2v49p1, d2v49t1, d2v49u1, d2v49v1, d2v49y1
    has additional subdomain(s) that are not in the common domain

Details for d2v49z1

PDB Entry: 2v49 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 4 of 4). This file contains the 50S subunit of Molecule 2.
PDB Compounds: (Z:) 50S ribosomal protein L25

SCOPe Domain Sequences for d2v49z1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v49z1 b.53.1.1 (Z:3-179) Ribosomal protein TL5 (general stress protein CTC) {Thermus thermophilus [TaxId: 274]}
yrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivlelp
dgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqeihr
dilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvpped

SCOPe Domain Coordinates for d2v49z1:

Click to download the PDB-style file with coordinates for d2v49z1.
(The format of our PDB-style files is described here.)

Timeline for d2v49z1: