Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.77: RL5-like [55281] (1 superfamily) beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654 |
Superfamily d.77.1: RL5-like [55282] (3 families) |
Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein) |
Protein Ribosomal protein L5 [55284] (5 species) synonym: 50S ribosomal protein L5p, HMAL5, HL13 |
Species Thermus thermophilus [TaxId:274] [82718] (6 PDB entries) |
Domain d2hgqg1: 2hgq G:3-182 [145341] Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1 |
PDB Entry: 2hgq (more details), 5.5 Å
SCOPe Domain Sequences for d2hgqg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgqg1 d.77.1.1 (G:3-182) Ribosomal protein L5 {Thermus thermophilus [TaxId: 274]} ldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqelal itgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrglnp nsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpfrk
Timeline for d2hgqg1:
View in 3D Domains from other chains: (mouse over for more information) d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1 |