Lineage for d2hgqg1 (2hgq G:3-182)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565168Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 2565169Superfamily d.77.1: RL5-like [55282] (3 families) (S)
  5. 2565170Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 2565171Protein Ribosomal protein L5 [55284] (5 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 2565253Species Thermus thermophilus [TaxId:274] [82718] (6 PDB entries)
  8. 2565258Domain d2hgqg1: 2hgq G:3-182 [145341]
    Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1

Details for d2hgqg1

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (G:) 50S ribosomal protein L5

SCOPe Domain Sequences for d2hgqg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgqg1 d.77.1.1 (G:3-182) Ribosomal protein L5 {Thermus thermophilus [TaxId: 274]}
ldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqelal
itgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrglnp
nsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpfrk

SCOPe Domain Coordinates for d2hgqg1:

Click to download the PDB-style file with coordinates for d2hgqg1.
(The format of our PDB-style files is described here.)

Timeline for d2hgqg1: