Lineage for d2hgq61 (2hgq 6:1-49)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3047480Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 3047481Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) (S)
  5. 3047482Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
    Pfam PF00468
  6. 3047483Protein Ribosomal protein L34p [144323] (3 species)
  7. 3047500Species Thermus thermophilus [TaxId:274] [161306] (15 PDB entries)
    Uniprot P80340 1-49
  8. 3047507Domain d2hgq61: 2hgq 6:1-49 [145334]
    Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1

Details for d2hgq61

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (6:) 50S ribosomal protein L34

SCOPe Domain Sequences for d2hgq61:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgq61 j.118.1.1 (6:1-49) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]}
mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrkr

SCOPe Domain Coordinates for d2hgq61:

Click to download the PDB-style file with coordinates for d2hgq61.
(The format of our PDB-style files is described here.)

Timeline for d2hgq61: