Lineage for d2hgqv1 (2hgq V:2-110)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2948717Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 2948718Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 2948719Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 2948720Protein Ribosomal protein L22 [54845] (5 species)
  7. 2948821Species Thermus thermophilus [TaxId:274] [160267] (10 PDB entries)
  8. 2948824Domain d2hgqv1: 2hgq V:2-110 [145356]
    Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqw1, d2hgqx1, d2hgqy1

Details for d2hgqv1

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (V:) 50S ribosomal protein L22

SCOPe Domain Sequences for d2hgqv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgqv1 d.55.1.1 (V:2-110) Ribosomal protein L22 {Thermus thermophilus [TaxId: 274]}
eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn
hdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek

SCOPe Domain Coordinates for d2hgqv1:

Click to download the PDB-style file with coordinates for d2hgqv1.
(The format of our PDB-style files is described here.)

Timeline for d2hgqv1: