Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily) alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta; |
Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) some topological similarity to ribosomal protein L22 automatically mapped to Pfam PF01196 |
Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein) |
Protein Prokaryotic ribosomal protein L17 [64265] (4 species) |
Species Thermus thermophilus [TaxId:274] [64266] (11 PDB entries) |
Domain d2hgqq1: 2hgq Q:14-118 [145352] Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1 |
PDB Entry: 2hgq (more details), 5.5 Å
SCOPe Domain Sequences for d2hgqq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgqq1 d.188.1.1 (Q:14-118) Prokaryotic ribosomal protein L17 {Thermus thermophilus [TaxId: 274]} sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
Timeline for d2hgqq1:
View in 3D Domains from other chains: (mouse over for more information) d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1 |