SCOPe 2.08: Domain d2hgqu1: 2hgq U:1-101

Lineage for d2hgqu1 (2hgq U:1-101)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.155: L21p-like [141090] (1 superfamily)
   core: sandwich, 6 strands in 2 sheets

4. Superfamily b.155.1: L21p-like [141091] (1 family)
   automatically mapped to Pfam PF00829

5. Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
   Pfam PF00829

6. Protein Ribosomal protein L21p [141093] (3 species)

7. Species Thermus thermophilus [TaxId:274] [158939] (15 PDB entries)
   Uniprot P60492 1-101

8. Domain d2hgqu1: 2hgq U:1-101 [145355]
   Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1

Details for d2hgqu1

PDB Entry: 2hgq, 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.

PDB Compounds: (U:) 50S ribosomal protein L21

SCOPe Domain Sequences for d2hgqu1:

Sequence; same for both SEQRES and ATOM records:

>d2hgqu1 b.155.1.1 (U:1-101) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]}
mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg

Timeline for d2hgqu1:

• d2hgqu1 first appeared in SCOP 1.75
  
• d2hgqu1 appears in SCOPe 2.07