Class g: Small proteins [56992] (100 folds) |
Fold g.42: Ribosomal protein L36 [57839] (1 superfamily) zinc-bound beta-ribbon motif |
Superfamily g.42.1: Ribosomal protein L36 [57840] (1 family) automatically mapped to Pfam PF00444 |
Family g.42.1.1: Ribosomal protein L36 [57841] (1 protein) |
Protein Ribosomal protein L36 [57842] (3 species) |
Species Thermus thermophilus [TaxId:274] [57843] (10 PDB entries) |
Domain d2hgq81: 2hgq 8:1-37 [136440] Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1 |
PDB Entry: 2hgq (more details), 5.5 Å
SCOPe Domain Sequences for d2hgq81:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgq81 g.42.1.1 (8:1-37) Ribosomal protein L36 {Thermus thermophilus [TaxId: 274]} mkvrasvkricdkckvirrhgrvyvicenpkhkqrqg
Timeline for d2hgq81:
View in 3D Domains from other chains: (mouse over for more information) d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1 |