Lineage for d2hgq81 (2hgq 8:1-37)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037437Fold g.42: Ribosomal protein L36 [57839] (1 superfamily)
    zinc-bound beta-ribbon motif
  4. 3037438Superfamily g.42.1: Ribosomal protein L36 [57840] (1 family) (S)
    automatically mapped to Pfam PF00444
  5. 3037439Family g.42.1.1: Ribosomal protein L36 [57841] (1 protein)
  6. 3037440Protein Ribosomal protein L36 [57842] (3 species)
  7. 3037476Species Thermus thermophilus [TaxId:274] [57843] (10 PDB entries)
  8. 3037479Domain d2hgq81: 2hgq 8:1-37 [136440]
    Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1

Details for d2hgq81

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (8:) 50S ribosomal protein L36

SCOPe Domain Sequences for d2hgq81:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgq81 g.42.1.1 (8:1-37) Ribosomal protein L36 {Thermus thermophilus [TaxId: 274]}
mkvrasvkricdkckvirrhgrvyvicenpkhkqrqg

SCOPe Domain Coordinates for d2hgq81:

Click to download the PDB-style file with coordinates for d2hgq81.
(The format of our PDB-style files is described here.)

Timeline for d2hgq81: