Lineage for d2hgq31 (2hgq 3:1-50)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216412Fold d.325: L28p-like [143799] (1 superfamily)
    unusual fold consisting of three beta-hairpins, that form a paper clip-like structure, and two helices; could have evolved from a glucocorticoid receptor-like zinc finger domain (57715)
  4. 2216413Superfamily d.325.1: L28p-like [143800] (2 families) (S)
    In early ribosomal structures, L28p has been misinterpreted as L31p. in the Ribosomal protein L28p family, there are sequences containing two CxxC pairs. Threading these sequences into this fold brings the four cysteines in a similar site to the zinc-binding site of glucocorticoid receptor-like zinc fingers. In the Ribosomal protein L31p, there are also members with two CxxC pairs. However, these won't form a putative zinc-binding site in this fold. The L31p family are classified here temporarily, until its true fold is known
  5. 2216446Family d.325.1.2: Ribosomal protein L31p [143804] (1 protein)
    Pfam PF01197
  6. 2216447Protein Ribosomal protein L31p [143805] (2 species)
  7. 2216458Species Thermus thermophilus [TaxId:274] [160711] (7 PDB entries)
    Uniprot Q5SJE1 1-50
  8. 2216463Domain d2hgq31: 2hgq 3:1-50 [145331]
    Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1

Details for d2hgq31

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (3:) 50S ribosomal protein L31

SCOPe Domain Sequences for d2hgq31:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgq31 d.325.1.2 (3:1-50) Ribosomal protein L31p {Thermus thermophilus [TaxId: 274]}
mkegihpklvpariicgcgnvietystkpeiyvevcskchpfytgqqrfv

SCOPe Domain Coordinates for d2hgq31:

Click to download the PDB-style file with coordinates for d2hgq31.
(The format of our PDB-style files is described here.)

Timeline for d2hgq31: