Lineage for d2hgqy1 (2hgq Y:3-179)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802937Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 2802938Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) (S)
  5. 2802939Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins)
  6. 2802974Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species)
    contains additional all-beta (sub)domain in the C-terminal extension
  7. 2802982Species Thermus thermophilus [TaxId:274] [63799] (16 PDB entries)
  8. 2802991Domain d2hgqy1: 2hgq Y:3-179 [145359]
    Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1
    has additional subdomain(s) that are not in the common domain

Details for d2hgqy1

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (Y:) 50S ribosomal protein L25

SCOPe Domain Sequences for d2hgqy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgqy1 b.53.1.1 (Y:3-179) Ribosomal protein TL5 (general stress protein CTC) {Thermus thermophilus [TaxId: 274]}
yrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivlelp
dgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqeihr
dilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvpped

SCOPe Domain Coordinates for d2hgqy1:

Click to download the PDB-style file with coordinates for d2hgqy1.
(The format of our PDB-style files is described here.)

Timeline for d2hgqy1: