Lineage for d2hgq21 (2hgq 2:2-60)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2178243Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 2178244Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 2178245Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 protein domains)
  6. 2178288Protein Prokaryotic ribosomal protein L30 [55131] (3 species)
    short-chain member of the family
  7. 2178326Species Thermus thermophilus [TaxId:274] [55132] (11 PDB entries)
  8. 2178331Domain d2hgq21: 2hgq 2:2-60 [145330]
    Other proteins in same PDB: d2hgq11, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1

Details for d2hgq21

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (2:) 50S ribosomal protein L30

SCOPe Domain Sequences for d2hgq21:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgq21 d.59.1.1 (2:2-60) Prokaryotic ribosomal protein L30 {Thermus thermophilus [TaxId: 274]}
prlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve

SCOPe Domain Coordinates for d2hgq21:

Click to download the PDB-style file with coordinates for d2hgq21.
(The format of our PDB-style files is described here.)

Timeline for d2hgq21: