Lineage for d2hgqk1 (2hgq K:56-148)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532147Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily)
    alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta
  4. 2532148Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family) (S)
    automatically mapped to Pfam PF03948
  5. 2532149Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein)
  6. 2532150Protein Ribosomal protein L9 C-domain [55655] (3 species)
  7. 2532183Species Thermus thermophilus [TaxId:274] [143635] (9 PDB entries)
    Uniprot Q5SLQ1 55-146
  8. 2532186Domain d2hgqk1: 2hgq K:56-148 [145344]
    Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1

Details for d2hgqk1

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (K:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2hgqk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgqk1 d.99.1.1 (K:56-148) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
krlaerkaeaerlkkilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrla
lekpikelgeyvltykphpevpiqlkvsvvaqe

SCOPe Domain Coordinates for d2hgqk1:

Click to download the PDB-style file with coordinates for d2hgqk1.
(The format of our PDB-style files is described here.)

Timeline for d2hgqk1: