SCOPe 2.08: Domain d2cnwd1: 2cnw D:21-90

Lineage for d2cnwd1 (2cnw D:21-90)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)
Family a.24.13.0: automated matches [229049] (1 protein)
not a true family
Protein automated matches [229050] (7 species)
not a true protein
Species Thermus aquaticus [TaxId:271] [255075] (4 PDB entries)

Domain d2cnwd1: 2cnw D:21-90 [130655]
Other proteins in same PDB: d2cnwa1, d2cnwa2, d2cnwb1, d2cnwb2, d2cnwc1, d2cnwc2, d2cnwd2, d2cnwe1, d2cnwe2, d2cnwf2
automated match to d1okkd1
protein/RNA complex; complexed with 5gp, alf, gdp, mg

Details for d2cnwd1

PDB Entry: 2cnw (more details), 2.39 Å

PDB Description: gdpalf4 complex of the srp gtpases ffh and ftsy

PDB Compounds: (D:) cell division protein ftsy

SCOPe Domain Sequences for d2cnwd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cnwd1 a.24.13.0 (D:21-90) automated matches {Thermus aquaticus [TaxId: 271]}
aipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlepde
rratlrklgf

SCOPe Domain Coordinates for d2cnwd1:

Click to download the PDB-style file with coordinates for d2cnwd1.
(The format of our PDB-style files is described here.)

Timeline for d2cnwd1: