SCOPe 2.08: Domain d2cnwf1: 2cnw F:26-78

Lineage for d2cnwf1 (2cnw F:26-78)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.0: automated matches [229049] (1 protein)
   not a true family

6. Protein automated matches [229050] (7 species)
   not a true protein

7. Species Thermus aquaticus [TaxId:271] [255075] (4 PDB entries)

8. Domain d2cnwf1: 2cnw F:26-78 [130659]
   Other proteins in same PDB: d2cnwa1, d2cnwa2, d2cnwb1, d2cnwb2, d2cnwc1, d2cnwc2, d2cnwd2, d2cnwe1, d2cnwe2, d2cnwf2
   automated match to d1okkd1
   protein/RNA complex; complexed with 5gp, alf, gdp, mg

Details for d2cnwf1

PDB Entry: 2cnw, 2.39 Å

PDB Description: gdpalf4 complex of the srp gtpases ffh and ftsy

PDB Compounds: (F:) cell division protein ftsy

SCOPe Domain Sequences for d2cnwf1:

Sequence; same for both SEQRES and ATOM records:

>d2cnwf1 a.24.13.0 (F:26-78) automated matches {Thermus aquaticus [TaxId: 271]}
gnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlep

Timeline for d2cnwf1:

• d2cnwf1 first appeared in SCOP 1.73
  
• d2cnwf1 appears in SCOPe 2.07