SCOPe 2.08: Domain d2cnwd2: 2cnw D:93-303

Lineage for d2cnwd2 (2cnw D:93-303)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein automated matches [190304] (16 species)
   not a true protein

7. Species Thermus aquaticus [TaxId:271] [255076] (4 PDB entries)

8. Domain d2cnwd2: 2cnw D:93-303 [130656]
   Other proteins in same PDB: d2cnwa1, d2cnwa2, d2cnwb1, d2cnwb2, d2cnwc1, d2cnwc2, d2cnwd1, d2cnwe1, d2cnwe2, d2cnwf1
   automated match to d1okkd2
   protein/RNA complex; complexed with 5gp, alf, gdp, mg

Details for d2cnwd2

PDB Entry: 2cnw, 2.39 Å

PDB Description: gdpalf4 complex of the srp gtpases ffh and ftsy

PDB Compounds: (D:) cell division protein ftsy

SCOPe Domain Sequences for d2cnwd2:

Sequence; same for both SEQRES and ATOM records:

>d2cnwd2 c.37.1.10 (D:93-303) automated matches {Thermus aquaticus [TaxId: 271]}
qkpkpvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdtfraaggtqlsew
gkrlsipviqgpegtdpaalaydavqamkargydllfvdtagrlhtkhnlmeelkkvkra
iakadpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgtakggvlipivrt
lkvpikfvgvgegpddlqpfdpeafvealle

Timeline for d2cnwd2:

• d2cnwd2 first appeared in SCOP 1.73
  
• d2cnwd2 appears in SCOPe 2.07