Lineage for d2cnwd2 (2cnw D:97-303)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 696576Family c.37.1.10: Nitrogenase iron protein-like [52652] (13 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 696692Protein GTPase domain of the signal recognition particle receptor FtsY [52666] (3 species)
  7. 696698Species Thermus aquaticus [TaxId:271] [102374] (5 PDB entries)
  8. 696704Domain d2cnwd2: 2cnw D:97-303 [130656]
    Other proteins in same PDB: d2cnwa1, d2cnwa2, d2cnwb1, d2cnwb2, d2cnwc1, d2cnwc2, d2cnwd1, d2cnwe1, d2cnwf1
    automatically matched to d1okkd2
    complexed with 5gp, alf, gdp, mg

Details for d2cnwd2

PDB Entry: 2cnw (more details), 2.39 Å

PDB Description: gdpalf4 complex of the srp gtpases ffh and ftsy
PDB Compounds: (D:) cell division protein ftsy

SCOP Domain Sequences for d2cnwd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cnwd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}
pvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdtfraaggtqlsewgkrl
sipviqgpegtdpaalaydavqamkargydllfvdtagrlhtkhnlmeelkkvkraiaka
dpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgtakggvlipivrtlkvp
ikfvgvgegpddlqpfdpeafvealle

SCOP Domain Coordinates for d2cnwd2:

Click to download the PDB-style file with coordinates for d2cnwd2.
(The format of our PDB-style files is described here.)

Timeline for d2cnwd2: