![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
![]() | Protein automated matches [190304] (16 species) not a true protein |
![]() | Species Thermus aquaticus [TaxId:271] [255076] (4 PDB entries) |
![]() | Domain d2cnwf2: 2cnw F:97-303 [130660] Other proteins in same PDB: d2cnwa1, d2cnwa2, d2cnwb1, d2cnwb2, d2cnwc1, d2cnwc2, d2cnwd1, d2cnwe1, d2cnwe2, d2cnwf1 automated match to d1okkd2 protein/RNA complex; complexed with 5gp, alf, gdp, mg |
PDB Entry: 2cnw (more details), 2.39 Å
SCOPe Domain Sequences for d2cnwf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cnwf2 c.37.1.10 (F:97-303) automated matches {Thermus aquaticus [TaxId: 271]} pvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdtfraaggtqlsewgkrl sipviqgpegtdpaalaydavqamkargydllfvdtagrlhtkhnlmeelkkvkraiaka dpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgtakggvlipivrtlkvp ikfvgvgegpddlqpfdpeafvealle
Timeline for d2cnwf2: