Lineage for d2cnwf2 (2cnw F:97-303)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869314Protein automated matches [190304] (16 species)
    not a true protein
  7. 2869413Species Thermus aquaticus [TaxId:271] [255076] (4 PDB entries)
  8. 2869419Domain d2cnwf2: 2cnw F:97-303 [130660]
    Other proteins in same PDB: d2cnwa1, d2cnwa2, d2cnwb1, d2cnwb2, d2cnwc1, d2cnwc2, d2cnwd1, d2cnwe1, d2cnwe2, d2cnwf1
    automated match to d1okkd2
    protein/RNA complex; complexed with 5gp, alf, gdp, mg

Details for d2cnwf2

PDB Entry: 2cnw (more details), 2.39 Å

PDB Description: gdpalf4 complex of the srp gtpases ffh and ftsy
PDB Compounds: (F:) cell division protein ftsy

SCOPe Domain Sequences for d2cnwf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cnwf2 c.37.1.10 (F:97-303) automated matches {Thermus aquaticus [TaxId: 271]}
pvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdtfraaggtqlsewgkrl
sipviqgpegtdpaalaydavqamkargydllfvdtagrlhtkhnlmeelkkvkraiaka
dpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgtakggvlipivrtlkvp
ikfvgvgegpddlqpfdpeafvealle

SCOPe Domain Coordinates for d2cnwf2:

Click to download the PDB-style file with coordinates for d2cnwf2.
(The format of our PDB-style files is described here.)

Timeline for d2cnwf2: