SCOPe 2.08: Domain d2cnwc1: 2cnw C:4-88

Lineage for d2cnwc1 (2cnw C:4-88)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (3 species)

7. Species Thermus aquaticus [TaxId:271] [47367] (16 PDB entries)

8. Domain d2cnwc1: 2cnw C:4-88 [130653]
   Other proteins in same PDB: d2cnwa2, d2cnwb2, d2cnwc2, d2cnwd1, d2cnwd2, d2cnwe1, d2cnwe2, d2cnwf1, d2cnwf2
   automated match to d1okka1
   protein/RNA complex; complexed with 5gp, alf, gdp, mg

Details for d2cnwc1

PDB Entry: 2cnw, 2.39 Å

PDB Description: gdpalf4 complex of the srp gtpases ffh and ftsy

PDB Compounds: (C:) signal recognition particle protein

SCOPe Domain Sequences for d2cnwc1:

Sequence; same for both SEQRES and ATOM records:

>d2cnwc1 a.24.13.1 (C:4-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
qlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreealgkq
vlesltpaevilatvyealkealgg

Timeline for d2cnwc1:

• d2cnwc1 first appeared in SCOP 1.73
  
• d2cnwc1 appears in SCOPe 2.07