PDB entry 2cnw

View 2cnw on RCSB PDB site
Description: gdpalf4 complex of the srp gtpases ffh and ftsy
Class: signal recognition
Keywords: inner membrane, membrane targeting, nucleotide-binding, GDP- aluminum fluoride, signal recognition particle, RNA-binding, GTP-binding, cell division, signal sequence recognition, srp, ffh, ftsy, gtpase, membrane, cell cycle, cell division/complex, signal recognition
Deposited on 2006-05-24, released 2006-10-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.186
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal recognition particle protein
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cnwa1, d2cnwa2
  • Chain 'B':
    Compound: signal recognition particle protein
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cnwb1, d2cnwb2
  • Chain 'C':
    Compound: signal recognition particle protein
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cnwc1, d2cnwc2
  • Chain 'D':
    Compound: cell division protein ftsy
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cnwd1, d2cnwd2
  • Chain 'E':
    Compound: cell division protein ftsy
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cnwe1, d2cnwe2
  • Chain 'F':
    Compound: cell division protein ftsy
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cnwf1, d2cnwf2
  • Heterogens: GDP, MG, ALF, 5GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cnwA (A:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cnwA (A:)
    qlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreealgkq
    vlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklalyyk
    gkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarleardl
    ilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvtglv
    ltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cnwB (B:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cnwB (B:)
    qlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreealgkq
    vlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklalyyk
    gkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarleardl
    ilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvtglv
    ltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cnwC (C:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cnwC (C:)
    qlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreealgkq
    vlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklalyyk
    gkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarleardl
    ilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvtglv
    ltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cnwD (D:)
    aipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlepde
    rratlrklgfnpqkpkpvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdt
    fraaggtqlsewgkrlsipviqgpegtdpaalaydavqamkargydllfvdtagrlhtkh
    nlmeelkkvkraiakadpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgt
    akggvlipivrtlkvpikfvgvgegpddlqpfdpeafvealled
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cnwD (D:)
    aipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlepde
    rratlrklgfqkpkpvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdtfr
    aaggtqlsewgkrlsipviqgpegtdpaalaydavqamkargydllfvdtagrlhtkhnl
    meelkkvkraiakadpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgtak
    ggvlipivrtlkvpikfvgvgegpddlqpfdpeafvealle
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2cnwE (E:)
    aipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlepde
    rratlrklgfnpqkpkpvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdt
    fraaggtqlsewgkrlsipviqgpegtdpaalaydavqamkargydllfvdtagrlhtkh
    nlmeelkkvkraiakadpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgt
    akggvlipivrtlkvpikfvgvgegpddlqpfdpeafvealled
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cnwE (E:)
    pwggnleevleelemallaadvglsateeilqevrgrkdlkeavkeklvgmlepderrat
    lrklgfnpqkpkpvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdtfraa
    ggtqlsewgkrlsipviqgpegtdpaalaydavqamkargydllfvdtagrlhtkhnlme
    elkkvkraiakadpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgtakgg
    vlipivrtlkvpikfvgvgegpddlqpfdpeafvealle
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2cnwF (F:)
    aipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlepde
    rratlrklgfnpqkpkpvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdt
    fraaggtqlsewgkrlsipviqgpegtdpaalaydavqamkargydllfvdtagrlhtkh
    nlmeelkkvkraiakadpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgt
    akggvlipivrtlkvpikfvgvgegpddlqpfdpeafvealled
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cnwF (F:)
    gnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmleppvepkgr
    vvlvvgvngvgktttiaklgryyqnlgkkvmfcagdtfraaggtqlsewgkrlsipviqg
    pegtdpaalaydavqamkargydllfvdtagrlhtkhnlmeelkkvkraiakadpeepke
    vwlvldavtgqngleqakkfheavgltgvivtkldgtakggvlipivrtlkvpikfvgvg
    egpddlqpfdpeafvealle