| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) ![]() |
| Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins) |
| Protein Signal recognition particle receptor, FtsY [47368] (3 species) |
| Species Thermus aquaticus [TaxId:271] [101122] (3 PDB entries) |
| Domain d2cnwe1: 2cnw E:23-78 [130657] Other proteins in same PDB: d2cnwa1, d2cnwa2, d2cnwb1, d2cnwb2, d2cnwc1, d2cnwc2, d2cnwd1, d2cnwd2, d2cnwe2, d2cnwf1, d2cnwf2 automatically matched to d1okkd1 protein/RNA complex; complexed with 5gp, alf, gdp, mg |
PDB Entry: 2cnw (more details), 2.39 Å
SCOPe Domain Sequences for d2cnwe1:
Sequence, based on SEQRES records: (download)
>d2cnwe1 a.24.13.1 (E:23-78) Signal recognition particle receptor, FtsY {Thermus aquaticus [TaxId: 271]}
pwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlep
>d2cnwe1 a.24.13.1 (E:23-78) Signal recognition particle receptor, FtsY {Thermus aquaticus [TaxId: 271]}
pwggnleevleelemallaadvglsateeilqevrgrkdlkeavkeklvgmlep
Timeline for d2cnwe1: