Lineage for d2cnwe1 (2cnw E:23-78)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2313661Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) (S)
  5. 2313662Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)
  6. 2313666Protein Signal recognition particle receptor, FtsY [47368] (3 species)
  7. 2313673Species Thermus aquaticus [TaxId:271] [101122] (3 PDB entries)
  8. 2313676Domain d2cnwe1: 2cnw E:23-78 [130657]
    Other proteins in same PDB: d2cnwa1, d2cnwa2, d2cnwb1, d2cnwb2, d2cnwc1, d2cnwc2, d2cnwd1, d2cnwd2, d2cnwe2, d2cnwf1, d2cnwf2
    automatically matched to d1okkd1
    protein/RNA complex; complexed with 5gp, alf, gdp, mg

Details for d2cnwe1

PDB Entry: 2cnw (more details), 2.39 Å

PDB Description: gdpalf4 complex of the srp gtpases ffh and ftsy
PDB Compounds: (E:) cell division protein ftsy

SCOPe Domain Sequences for d2cnwe1:

Sequence, based on SEQRES records: (download)

>d2cnwe1 a.24.13.1 (E:23-78) Signal recognition particle receptor, FtsY {Thermus aquaticus [TaxId: 271]}
pwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlep

Sequence, based on observed residues (ATOM records): (download)

>d2cnwe1 a.24.13.1 (E:23-78) Signal recognition particle receptor, FtsY {Thermus aquaticus [TaxId: 271]}
pwggnleevleelemallaadvglsateeilqevrgrkdlkeavkeklvgmlep

SCOPe Domain Coordinates for d2cnwe1:

Click to download the PDB-style file with coordinates for d2cnwe1.
(The format of our PDB-style files is described here.)

Timeline for d2cnwe1: